Infosec Institute

Open Bug Bounty mentioned in the
Top 6 Bug Bounty programs of
2022 by the InfoSec Institute

The Hacker News

Open Bug Bounty named among the
Top 5 Bug Bounty programs of 2021
by The Hacker News

Platform update: please use our new authentication mechanism to securely use the Open Bug Bounty Platform.
For security researchers
Report a Vulnerability
Submit, help fixing, get kudos.
For website owners
Start a Bug Bounty
Run your bounty program for free.
1,704,660 coordinated disclosures
1,383,227 fixed vulnerabilities
1,991 bug bounty programs, 3,919 websites
47,013 researchers, 1,651 honor badges

Are you sure you want to delete the vulnerability?

Yes No

This feature enables you to send additional notifications to the website owners or admins after the vulnerability is submitted. The total number of additional notification is limited to 10, and to 1 in 24 hours.

Notify specific security contact:


To my best knowledge this email belongs to the website owner/admin


winnipegcriminaldefencelawyer.ca Cross Site Scripting Vulnerability
Report ID: OBB-1169493

Security Researcher g0bl1nsec Helped patch 3955 vulnerabilities
Received 4 Coordinated Disclosure badges
Received 3 recommendations
, a holder of 4 badges for responsible and coordinated disclosure, found Cross Site Scripting security vulnerability affecting winnipegcriminaldefencelawyer.ca website and its users.

Following the coordinated and responsible vulnerability disclosure guidelines of the ISO 29147 standard, Open Bug Bounty has:

      a. verified the vulnerability and confirmed its existence;
      b. notified the website operator about its existence.

Affected Website:winnipegcriminaldefencelawyer.ca  
Open Bug Bounty Program:Create your bounty program now. It's open and free.
Vulnerable Application:Custom Code
Vulnerability Type:XSS (Cross Site Scripting) / CWE-79
CVSSv3 Score:6.1 [CVSS:3.0/AV:N/AC:L/PR:N/UI:R/S:C/C:L/I:L/A:N]
Disclosure Standard:Coordinated Disclosure based on ISO 29147 guidelines
Discovered and Reported by:g0bl1nsec Helped patch 3955 vulnerabilities
Received 4 Coordinated Disclosure badges
Received 3 recommendations
Remediation Guide:OWASP XSS Prevention Cheat Sheet
Export Vulnerability Data:Bugzilla Vulnerability Data
JIRA Vulnerability Data [ Configuration ]
Mantis Vulnerability Data
Splunk Vulnerability Data
XML Vulnerability Data [ XSD ]

Vulnerable URL:

HTTP POST data:

Mirror: Click here to view the mirror

Coordinated Disclosure Timeline

Vulnerability Reported:22 May, 2020 21:14 GMT
Vulnerability Verified:22 May, 2020 21:30 GMT
Website Operator Notified:22 May, 2020 21:30 GMT
a. Using the ISO 29147 guidelines
b. Using publicly available security contacts
c. Using Open Bug Bounty notification framework
d. Using security contacts provided by the researcher
Public Report Published [without technical details]:22 May, 2020 21:30 GMT
Public Disclosure:  InformationA security researcher can delete the report before public disclosure, afterwards the report cannot be deleted or modified anymore. The researcher can also postpone public disclosure date as long as reasonably required to remediate the vulnerability.20 August, 2020 21:14 GMT

For Website Operators and Owners

Please read how Open Bug Bounty helps make your websites secure and then contact the researcher directly to get the vulnerability details. The researcher may also help you fix the vulnerability and advice on how to prevent similar issues:

How it works and what's next

For remediation best practices, please also refer to OWASP remediation guidelines. More information about coordinate and responsible disclosure on Open Bug Bounty is available here.

DISCLAIMER: Open Bug Bounty is a non-profit project, we never act as an intermediary between website owners and security researchers. We have no relationship or control over the researchers. Our role is limited to independent verification of the submitted reports and proper notification of website owners by all reasonably available means.

winnipegcriminaldefencelawyer.ca

Website Overview and Rating

SSL/TLS Server Test:C    View Results
Web Server Security Test:B+    View Results
Malware Test:Click here
Domain Health Report:Click here

Latest Submissions

OBB-ID Reported by Status Reported on
unpatched
14.08.2022
unpatched
22.05.2020

  Latest Patched

 25.04.2024 xaxim.sc.gov.br
 25.04.2024 lacerdopolis.sc.gov.br
 24.04.2024 tap.mk.gov.lv
 23.04.2024 data.aad.gov.au
 23.04.2024 bitporno.to
 23.04.2024 sys01.lib.hkbu.edu.hk
 23.04.2024 srvm.gov.za
 22.04.2024 stc.edu.hk
 22.04.2024 friv5online.com
 20.04.2024 brandonfowler.me

  Latest Blog Posts

04.12.2023 by BAx99x
Unmasking the Power of Cross-Site Scripting (XSS): Types, Exploitation, Detection, and Tools
04.12.2023 by a13h1_
$1120: ATO Bug in Twitter’s
04.12.2023 by ClumsyLulz
How I found a Zero Day in W3 Schools
04.12.2023 by 24bkdoor
Hack the Web like a Pirate: Identifying Vulnerabilities with Style
04.12.2023 by 24bkdoor
Navigating the Bounty Seas with Open Bug Bounty

  Recent Recommendations

    22 April, 2024
    genoverband:
Thank you for your invaluable help in ensuring the security of our domain and its visitors!
    10 April, 2024
    Mars:
Hatim uncovered a XSS bug that we were able to quickly resolve. Thanks very much for your assistance and help.
    8 April, 2024
    Panthermedia:
Thanks to the support of Hatim Chabik, we were able to identify and solve an XSS bug.
    5 April, 2024
    pubpharm:
Pooja found a XSS vulnerability on our website and provided us with the needed Information for replication and fixing the issue. Which she verified afterwards.
We thank her for the reporting and assistance.
    2 April, 2024
    genoverband:
Thank you for your invaluable help in ensuring the security of our domain and its visitors!